Transcript | Ll_transcript_226199 |
---|---|
CDS coordinates | 287-1006 (+) |
Peptide sequence | MARKSVLIGCNYRGTKAELKGCINDVWKMHTCLIKRYNFCEEDIVVLIDTDESYTQPTGKNIRVELQRLVGSAMEGDVLFVHYSGHGTRLPAESGEEDDTGYDECIVPSDMNLITDDDFKDLVDELPRGVRLTIVSDSCHSGGLLKETKEQIGDSTKGAEDQDSGSGLSNFLHQKLENAFNSRGIHVPSALQHHRRIKHDEVEDRDTYLPHGQHHHVKNKSLPLSTLIDILKQKTGKDDI |
ORF Type | 3prime_partial |
Blastp | Metacaspase-4 from Arabidopsis with 60.73% of identity |
---|---|
Blastx | Metacaspase-4 from Arabidopsis with 60.73% of identity |
Eggnog | Metacaspase(ENOG410Y41C) |
Kegg | Link to kegg annotations (AT1G79340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449305.1) |
Pfam | Caspase domain (PF00656.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer