Protein coding transcript 210125

• Transcript: Ll_transcript_226202
• CDS coordinates: 316-1050 (+)
• Peptide sequence: MARKAVLIGCNYPGTKAELRGCINDVWKMHSSLINRFGFSEDDIVVLIDTDDSYTQPTGKNIRSALQRLIRSSEEGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFKDLVDELPRGVRLTIVSDSCHSGGLLKETKEQIGDSTKGAEDQDSGSGLSNFLHQKLENAFNSRGIHVPSALQHHRRIKHDEVEDRDTYLPHGQHHHVKNKSLPLSTLIDILKQKTGKDDIDVGKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_226202

• Blastp: Metacaspase-5 from Arabidopsis with 62.65% of identity
• Blastx: Metacaspase-4 from Arabidopsis with 61.51% of identity
• Eggnog: Metacaspase(ENOG410Y41C)
• Kegg: Link to kegg annotations (AT1G79330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449305.1)
• Pfam: Caspase domain (PF00656.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;