Transcript | Ll_transcript_227401 |
---|---|
CDS coordinates | 3620-4270 (+) |
Peptide sequence | MQKYDVKVMFLRNAFLVDTVTESIGRVLRLDSIETGDMWKGADILIFDSWHWWLHTGRKQPWDLIEDGSNRYRDMNRLVAYEKGLKTWSKWVDDNIDTNKTRVFFQGVSPDHLNGAKWGQAGAKFCEGQMRPVSGLNYPGGAHPAEIVLEKVLRGMSKPVYLLNITTLSQLRKDGHPSVYGHGGHNDMDCSHWCLPGVPDTWNLLLYAALLQNYAL* |
ORF Type | complete |
Blastp | Protein trichome birefringence-like 43 from Arabidopsis with 56.4% of identity |
---|---|
Blastx | Protein trichome birefringence-like 43 from Arabidopsis with 57% of identity |
Eggnog | Pfam:DUF231(ENOG4111BK6) |
Kegg | Link to kegg annotations (AT2G30900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459204.1) |
Pfam | GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer