Protein coding transcript 210157

• Transcript: Ll_transcript_227405
• CDS coordinates: 141-581 (+)
• Peptide sequence: MGWYLSIHIVFFLSLFISNIHGDDHHNEEKRGCDLFHGSWVVDDESSYPLYESYECPFIEKQFDCQNNGRPDKLYLSYRWKPLGCNLPRYTQQHPLIISFYSVFSTPYKVHCFSHNQVVFLLFDTLLELTLMHSISRYYSLGQKLV*
• ORF Type: complete

Annotations of Ll_transcript_227405

• Blastp: Protein trichome birefringence-like 43 from Arabidopsis with 46.99% of identity
• Blastx: Protein trichome birefringence-like 43 from Arabidopsis with 45.56% of identity
• Eggnog: Pfam:DUF231(ENOG4111BK6)
• Kegg: Link to kegg annotations (AT2G30900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459206.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;