Protein coding transcript 210200

• Transcript: Ll_transcript_224929
• CDS coordinates: 737-1471 (+)
• Peptide sequence: MVFERGPRAFINETAKFLLPGGLAEGYSIKNLYQSASDYINERVTLLNCLRCSLATFLAQLYMEIDKIGADLVTDPESKLPSLLVTINELFSTLEASIGHLHAIRQSDSSVDGSYSIPLLFEKLPEINQEGSQWTDCEIKDAISSVYQNLNKLDSYISVLVTKHKKPRKITQYWIRYTCGAVGLSACSVWLLRHSSLTGSSDLDNWVQEAKDSTVGFFKDHVEQPVHFFFLCTDVTFFPLLPSL*
• ORF Type: complete

Annotations of Ll_transcript_224929

• Blastp: Protein DGS1, mitochondrial from Arabidopsis with 61.5% of identity
• Blastx: Protein DGS1, mitochondrial from Arabidopsis with 60.81% of identity
• Eggnog: nuclear control of ATPase protein(ENOG4110107)
• Kegg: Link to kegg annotations (AT5G12290)
• CantataDB: Link to cantataDB annotations (CNT0002967)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460260.1)
• Pfam: ATP synthase regulation protein NCA2 (PF08637.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;