Transcript | Ll_transcript_224930 |
---|---|
CDS coordinates | 737-1708 (+) |
Peptide sequence | MVFERGPRAFINETAKFLLPGGLAEGYSIKNLYQSASDYINERVTLLNCLRCSLATFLAQLYMEIDKIGADLVTDPESKLPSLLVTINELFSTLEASIGHLHAIRQSDSSVDGSYSIPLLFEKLPEINQEGSQWTDCEIKDAISSVYQNLNKLDSYISVLVTKHKKPRKITQYWIRYTCGAVGLSACSVWLLRHSSLTGSSDLDNWVQEAKDSTVGFFKDHVEQPLLSIRDELFETFRKRHQGIMDHEEVQLTSDSLHRMLLAFSEQTKGQKLPENASDHEMIEIVMDRYEKELAHPIQNLVNGELARALLIQVQKLKLDTET* |
ORF Type | complete |
Blastp | Protein DGS1, mitochondrial from Arabidopsis with 65.63% of identity |
---|---|
Blastx | Protein DGS1, mitochondrial from Arabidopsis with 61.7% of identity |
Eggnog | nuclear control of ATPase protein(ENOG4110107) |
Kegg | Link to kegg annotations (AT5G12290) |
CantataDB | Link to cantataDB annotations (CNT0002967) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460260.1) |
Pfam | ATP synthase regulation protein NCA2 (PF08637.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer