Protein coding transcript 210292

• Transcript: Ll_transcript_227503
• CDS coordinates: 2-304 (+)
• Peptide sequence: FHQLFLVQCYEVMLSTFFLQLKLDGVEVDEEQTISDPELLAEIMDIREEVEEATNSETLNHILSQMQEKMQTWSTAFADAFQSQKFEEAKTSIQRMTYYSR
• ORF Type: internal

Annotations of Ll_transcript_227503

• Blastp: Iron-sulfur cluster co-chaperone protein HscB, mitochondrial from Homo with 30.1% of identity
• Blastx: Iron-sulfur cluster co-chaperone protein HscB, mitochondrial from Homo with 30.1% of identity
• Eggnog: protein oligomerization(COG1076)
• Kegg: Link to kegg annotations (150274)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443103.1)
• Pfam: HSCB C-terminal oligomerisation domain (PF07743.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;