Protein coding transcript 2103

• Transcript: Ll_transcript_324818
• CDS coordinates: 37-462 (+)
• Peptide sequence: MKLNKFVSSSRRKSRKRHFTAPSHIRRKLLSAPLSKELRQKYNVKSMPVRKDDEVQVVRGHYKGQQVGKVVQCYRKKWVIYIERIQREKANGASVYVGIHPSKCVIVKLKIDKDRKNILDRRAKGRLAALGKDKGKYTEEST
• ORF Type: 3prime_partial

Annotations of Ll_transcript_324818

• Blastp: 60S ribosomal protein L26 from Mus with 75.89% of identity
• Blastx: 60S ribosomal protein L26 from Mus with 75.89% of identity
• Eggnog: One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit (By similarity)(COG0198)
• Kegg: Link to kegg annotations (19941)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016201632.2)
• Pfam: Ribosomal proteins L26 eukaryotic, L24P archaeal (PF16906.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;