Transcript | Ll_transcript_226370 |
---|---|
CDS coordinates | 278-916 (+) |
Peptide sequence | MQPKSETNGMRPDPHSFQPSIGYAEHWWRGIAYNPIAQTMSEANTTNSSSLDCPNGDSESSEEGRSLSNSGLNEEEDGATKDSQHAAPNQTENYGQEQQGMQHTSASANSVLEEGPTQTPQLELVGHSIACATTPYQDPYHGGIMAPYGHQPLGYASFMGMPHAGMPLPLEMAQEPVYVNAKQYQGILRRRQARAKAELERKLIKARKVQMH* |
ORF Type | complete |
Blastp | Nuclear transcription factor Y subunit A-1 from Arabidopsis with 49.75% of identity |
---|---|
Blastx | Nuclear transcription factor Y subunit A-1 from Arabidopsis with 50.26% of identity |
Eggnog | Nuclear transcription factor Y(COG5224) |
Kegg | Link to kegg annotations (AT5G12840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434589.1) |
Pfam | CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer