Protein coding transcript 210353

• Transcript: Ll_transcript_226378
• CDS coordinates: 3371-3760 (+)
• Peptide sequence: MRRARGSGGRFAKKSDAEASGKEKDAGSGPVLSSQSISSSGSEPLPSDSAETWNSPNMLQQDARGSKAQSRLETPNYENGSGSYHNPNGMQSSTYHMHSGERGEEGDCSGQQRGTISSEHASQRRLAIQ*
• ORF Type: complete

Annotations of Ll_transcript_226378

• Blastp: Nuclear transcription factor Y subunit A-9 from Arabidopsis with 41.67% of identity
• Blastx: Nuclear transcription factor Y subunit A-9 from Arabidopsis with 76.27% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT3G20910)
• CantataDB: Link to cantataDB annotations (CNT0002912)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;