Protein coding transcript 210358

• Transcript: Ll_transcript_226392
• CDS coordinates: 223-771 (+)
• Peptide sequence: MQSKSETNPTRSDPHSFQPNNVYAEPWWRGIGYNPIAQTISGANATKSSSLDCPNGDSESNEGQSLSNSGLNEEDDSAAKDSQLAAPNQTENFGHEQQGMQQTSAPAPSVREDAHTQTPQLELVGHSIACATNPYQDPYFGGMMTAYGHQQLGYAPFMGIPHARMPLPLEMAQEPVYVNAKQY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_226392

• Blastp: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 50% of identity
• Blastx: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 50% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT5G12840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;