Protein coding transcript 210361

• Transcript: Ll_transcript_226359
• CDS coordinates: 213-545 (+)
• Peptide sequence: MQSKSETNPTRSDPHSFQPNNVYAEPWWRGIGYNPIAQTISGANATKSSSLDCPNGDSESNEGQSLSNSGLNEEDDSAAKDSQLAAPNQTGGLEYSVTILNSKIKGKINR*
• ORF Type: complete

Annotations of Ll_transcript_226359

• Blastp: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 44.32% of identity
• Blastx: Nuclear transcription factor Y subunit A-1 from Arabidopsis with 44.32% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT5G12840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;