Transcript | Ll_transcript_226362 |
---|---|
CDS coordinates | 282-860 (+) |
Peptide sequence | MGMPHARMPLPLEMTQEPVYVNAKQYKGILRRRQARAKAELERKLIKSRKPYLHESRHQHALRRARGSGGRFAKKSDAGASGKEKDTASGPVLSSQSISSSGSEPLPSHSAETLLHSPTMLQQDARGSNARSKLEAPNYENGSGSYNNHNNALQSPTYHMHSGERAEEGDCSGQQRGSISSEHASQRRLAIQ* |
ORF Type | complete |
Blastp | Nuclear transcription factor Y subunit A-9 from Arabidopsis with 52.08% of identity |
---|---|
Blastx | Nuclear transcription factor Y subunit A-9 from Arabidopsis with 50% of identity |
Eggnog | Nuclear transcription factor Y(COG5224) |
Kegg | Link to kegg annotations (AT3G20910) |
CantataDB | Link to cantataDB annotations (CNT0002912) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449881.1) |
Pfam | CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer