Protein coding transcript 210422

• Transcript: Ll_transcript_225064
• CDS coordinates: 102-815 (+)
• Peptide sequence: MKLTVKTLKGTHFEIRVHPNDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLAHNNVSEDAFLVVMLSKSKTLGSAGTSSTQPASNPPTTVSTSNSTPQPQTEASNNHAPATDAATTNLSTDTYGQAASNLVAGGNLEQTIQEIMDMGGGNWDRDTVSRALRAAYNNPERAVDYLYSGIPEAAEVAVPASHFPSSQTTETGGVTAGAVSGVPNSSPLNMFPQVKLMILSG*
• ORF Type: complete

Annotations of Ll_transcript_225064

• Blastp: Ubiquitin receptor RAD23b from Arabidopsis with 63.52% of identity
• Blastx: Ubiquitin receptor RAD23b from Arabidopsis with 61.7% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G79650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447638.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;