Transcript | Ll_transcript_225064 |
---|---|
CDS coordinates | 102-815 (+) |
Peptide sequence | MKLTVKTLKGTHFEIRVHPNDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLAHNNVSEDAFLVVMLSKSKTLGSAGTSSTQPASNPPTTVSTSNSTPQPQTEASNNHAPATDAATTNLSTDTYGQAASNLVAGGNLEQTIQEIMDMGGGNWDRDTVSRALRAAYNNPERAVDYLYSGIPEAAEVAVPASHFPSSQTTETGGVTAGAVSGVPNSSPLNMFPQVKLMILSG* |
ORF Type | complete |
Blastp | Ubiquitin receptor RAD23b from Arabidopsis with 63.52% of identity |
---|---|
Blastx | Ubiquitin receptor RAD23b from Arabidopsis with 61.7% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT1G79650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447638.1) |
Pfam | Ubiquitin family (PF00240.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer