Protein coding transcript 210453

• Transcript: Ll_transcript_227449
• CDS coordinates: 3236-3958 (-)
• Peptide sequence: VMLCSIPRGHASGQFNNAEKHYHITYKEVLAVKYEIRKFDFYLRGHTFEVQMDNSSLPKILEFKNKMPPDPQILRLKSWFSIYDFTYKHIKGNQNLIPDFLSRPNKPISLITTINTLPLILMVNHLPDFASTTRDLPPGVDLSFPPGKLKEYAKNRLHYFLHKALTGYKDSFQENLFHPDILSIMSSQSILTIDISSQRTYYGTHGVSLFYMSLLLLCKLRQHTGSSLISKIIIICFGLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_227449

• Blastp: Genome polyprotein from Petuvirus with 42.74% of identity
• Blastx: Genome polyprotein from Petuvirus with 48.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (921337)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013459335.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;