Protein coding transcript 210455

• Transcript: Ll_transcript_227454
• CDS coordinates: 157-714 (+)
• Peptide sequence: MLALYKDLTLLLQNLLQEDDFYRIRLPSNVLTPPGRDYIISSVKARCLPGDGLEEHFVIHTEGVNILAVNYGAPGACAYPRQLKRPTRWSFKSHTILKNTEQAPRAPVFAEDVFGGEEGESEIVKPIERSFWAKYWMYVIPLGLIVMNAVTQAMNMPEEQAGGQAGAQAQPGAVQRGTNSAVRRR*
• ORF Type: complete

Annotations of Ll_transcript_227454

• Blastp: ER membrane protein complex subunit 10 from Silurana with 24.83% of identity
• Blastx: -
• Eggnog: ER membrane protein complex subunit 10(ENOG4111PEN)
• Kegg: Link to kegg annotations (394497)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449848.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;