Transcript | Ll_transcript_227463 |
---|---|
CDS coordinates | 144-1064 (+) |
Peptide sequence | MSSSLFLRSLFLLSLSLFFLSFSLSFAFQSDELLLDDEEFGLEGGNSNSRASKPTTVDSTPSSTPSVSRKRFSDSSSTDSKIQFSLQHAFGDSDFSEAGNFSARIKTWSHGAQTLTKLRFFRNPFSEVEQKQFQNLLQEDDFYRIRLPSNVLTPPGRDYIISSVKARCLPGDGLEEHFVIHTEGVNILAVNYGAPGACAYPRQLKRPTRWSFKSHTILKNTEQAPRAPVFAEDVFGGEEGESEIVKPIERSFWAKYWMYVIPLGLIVMNAVTQAMNMPEEQAGGQAGAQAQPGAVQRGTNSAVRRR* |
ORF Type | complete |
Blastp | ER membrane protein complex subunit 10 from Silurana with 23.61% of identity |
---|---|
Blastx | ER membrane protein complex subunit 10 from Silurana with 23.56% of identity |
Eggnog | ER membrane protein complex subunit 10(ENOG4111PEN) |
Kegg | Link to kegg annotations (394497) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449848.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer