Transcript | Ll_transcript_227473 |
---|---|
CDS coordinates | 2699-3421 (-) |
Peptide sequence | VMLCSIPRGHASGQFNNAEKHYHITYKEVLAVKYEIRKFDFYLRGHTFEVQMDNSSLPKILEFKNKMPPDPQILRLKSWFSIYDFTYKHIKGNQNLIPDFLSRPNKPISLITTINTLPLILMVNHLPDFASTTRDLPPGVDLSFPPGKLKEYAKNRLHYFLHKALTGYKDSFQENLFHPDILSIMSSQSILTIDISSQRTYYGTHGVSLFYMSLLLLCKLRQHTGSSLISKIIIICFGLY* |
ORF Type | 5prime_partial |
Blastp | Genome polyprotein from Petuvirus with 42.74% of identity |
---|---|
Blastx | Genome polyprotein from Petuvirus with 48.98% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (921337) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449848.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer