| Transcript | Ll_transcript_227479 |
|---|---|
| CDS coordinates | 706-1275 (-) |
| Peptide sequence | MDNSSLPKILEFKNKMPPDPQILRLKSWFSIYDFTYKHIKGNQNLIPDFLSRPNKPISLITTINTLPLILMVNHLPDFASTTRDLPPGVDLSFPPGKLKEYAKNRLHYFLHKALTGYKDSFQENLFHPDILSIMSSQSILTIDISSQRTYYGTHGVSLFYMSLLLLCKLRQHTGSSLISKIIIICFGLY* |
| ORF Type | complete |
| Blastp | Genome polyprotein from Petuvirus with 37.04% of identity |
|---|---|
| Blastx | Genome polyprotein from Petuvirus with 46.77% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (921337) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013459335.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer