Transcript | Ll_transcript_281448 |
---|---|
CDS coordinates | 203-658 (+) |
Peptide sequence | MAGVHIPRVKLGSQGLEVSKLGFGCMGLTGGYNAPLAEEDGISIIKYAFNNGITFFDTADVYGANNANEVLVGKASKQLPREKIQIATKFGIEKFDLFNNLITIKGTPEYVRSCCEGSLKRLGVEYIDLYYQHRVDATVPIEETVRNFLLL* |
ORF Type | complete |
Blastp | Probable aldo-keto reductase 1 from Soja with 75.17% of identity |
---|---|
Blastx | Probable aldo-keto reductase 1 from Soja with 67.34% of identity |
Eggnog | Aldo keto reductase(COG0667) |
Kegg | Link to kegg annotations (100301897) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439928.1) |
Pfam | Aldo/keto reductase family (PF00248.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer