| Transcript | Ll_transcript_281454 |
|---|---|
| CDS coordinates | 1320-1751 (+) |
| Peptide sequence | MGELKKLVQEGKIKYIGLSEASPDTIRRAHAVHPITAVQMEWSLWTREIEEDIVPLCRELGIGIVPYSPLGRGFFAGKAVIESIPAESFLALQPRIRGENLDKNKILYYRIEKLAEKHGCKPSQLALSWLLHQGDDVVPIPGE* |
| ORF Type | complete |
| Blastp | Perakine reductase from Rauvolfia with 76.06% of identity |
|---|---|
| Blastx | Perakine reductase from Rauvolfia with 72.51% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AAX11684) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440495.1) |
| Pfam | Aldo/keto reductase family (PF00248.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer