Protein coding transcript 21053

• Transcript: Ll_transcript_281457
• CDS coordinates: 301-921 (+)
• Peptide sequence: MANIPIPRVKLGSQGLEVSKLGFGCMGLHGVYNAPVAEDVGISIIKYAFSKGITFFDTSDVYGAHANEVLVGKAIKDLRRDKIQIATKFGIVGIESNNVIVNGTPEYVRSCCEGSLERLGVDYIDLYYQHRVDTTVPIEDTMGELKKLVQEGKIKYIGLSEASPDTIRRAHAVHPITAVQMEWSLWTREIEEDIVPLCRYVADIST*
• ORF Type: complete

Annotations of Ll_transcript_281457

• Blastp: Probable aldo-keto reductase 1 from Soja with 75.38% of identity
• Blastx: Probable aldo-keto reductase 1 from Soja with 75.38% of identity
• Eggnog: Aldo keto reductase(COG0667)
• Kegg: Link to kegg annotations (100301897)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440495.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;