Protein coding transcript 21055

• Transcript: Ll_transcript_281471
• CDS coordinates: 1320-1697 (+)
• Peptide sequence: MGELKKLVQEGKIKYIGLSEASPDTIRRAHAVHPITAVQMEWSLWTREIEEDIVPLCRELGIGIVPYSPLGRGFFAGKAVIESIPAESFLVRALITYFFMTIGPLHCSPTYLFIRHYNRGYEAKT*
• ORF Type: complete

Annotations of Ll_transcript_281471

• Blastp: Probable aldo-keto reductase 1 from Soja with 83.33% of identity
• Blastx: Perakine reductase from Rauvolfia with 73.58% of identity
• Eggnog: Aldo keto reductase(COG0667)
• Kegg: Link to kegg annotations (100301897)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440495.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;