Transcript | Ll_transcript_226746 |
---|---|
CDS coordinates | 37-579 (+) |
Peptide sequence | MAMQLKPFTLRLGQSQPRNLNFPNKHQIVTRCSLRDSVSNTHNHKLVHQFNPKIPIEEAVTPPTSWYTDPSFFHLELHRIFYTGWQVVGSTEQIKDALDFFTGRLGDVEFVVCRDESGKVRAFHNVCRHHASLLASGSGQKSCFVCPYHGWTYGLNGALLKANRISGMRDFNVKVRSSVP* |
ORF Type | complete |
Blastp | Choline monooxygenase, chloroplastic from Arabidopsis with 68.22% of identity |
---|---|
Blastx | Choline monooxygenase, chloroplastic from Arabidopsis with 68.22% of identity |
Eggnog | rieske 2fe-2S domain-containing protein(COG4638) |
Kegg | Link to kegg annotations (AT4G29890) |
CantataDB | Link to cantataDB annotations (CNT0000705) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463425.1) |
Pfam | Rieske [2Fe-2S] domain (PF00355.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer