Protein coding transcript 210586

• Transcript: Ll_transcript_226753
• CDS coordinates: 2436-2849 (+)
• Peptide sequence: MRQMFERVSIQSCESNSGKSEENYDRLGRKAIYAFIYPNFMINRYGPWMDTNLVLPLGPNKCQVVFDYYLDHSLKDDKDYIENSLQDSEIVQMEDIVLCEGVQKGLQSPAYCVGRYAPRVEQAMHHFHCLLYENLTK*
• ORF Type: complete

Annotations of Ll_transcript_226753

• Blastp: Choline monooxygenase, chloroplastic from Arabidopsis with 67.42% of identity
• Blastx: Choline monooxygenase, chloroplastic from Arabidopsis with 67.42% of identity
• Eggnog: rieske 2fe-2S domain-containing protein(COG4638)
• Kegg: Link to kegg annotations (AT4G29890)
• CantataDB: Link to cantataDB annotations (CNT0000705)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463425.1)
• Pfam: Ring hydroxylating alpha subunit (catalytic domain) (PF00848.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;