Protein coding transcript 210591

• Transcript: Ll_transcript_226733
• CDS coordinates: 37-777 (+)
• Peptide sequence: MAMQLKPFTLRLGQSQPRNLNFPNKHQIVTRCSLRDSVSNTHNHKLVHQFNPKIPIEEAVTPPTSWYTDPSFFHLELHRIFYTGWQVVGSTEQIKDALDFFTGRLGDVEFVVCRDESGKVRAFHNVCRHHASLLASGSGQKSCFVCPYHGWTYGLNGALLKANRISGMRDFNVKDFGLIPIKVATWGPFVLVNLEKESLSQNEVDSHNVASEWLGSCSEILSTNGVDSSLSYVCRREYTIECNWKV*
• ORF Type: complete

Annotations of Ll_transcript_226733

• Blastp: Choline monooxygenase, chloroplastic from Arabidopsis with 63.55% of identity
• Blastx: Choline monooxygenase, chloroplastic from Arabidopsis with 63.55% of identity
• Eggnog: rieske 2fe-2S domain-containing protein(COG4638)
• Kegg: Link to kegg annotations (AT4G29890)
• CantataDB: Link to cantataDB annotations (CNT0000473)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463425.1)
• Pfam: Rieske [2Fe-2S] domain (PF00355.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;