Protein coding transcript 210630

• Transcript: Ll_transcript_227066
• CDS coordinates: 121-789 (+)
• Peptide sequence: MLTHIGSCFLKPPPLSAAPISHSRFQNTKLLRVNCSYSSFEVRDVSYQPPGTPLKLLNSVSFSLPDKSLGLIFGQSGSGKTTLLQLLAGINKPTSGSICTQKYGNDGNPSQPPEPLVPERVGIVFQFPERYFVADSVLDEVTFGWPRQKDSYQLRENLAQGLQRAINWVGLSGIPLDKNPHSLSGGYKRRLALAIQLVQIPDLLILDEPLAGLGIKLQPLTS*
• ORF Type: complete

Annotations of Ll_transcript_227066

• Blastp: ABC transporter I family member 11, chloroplastic from Arabidopsis with 73.2% of identity
• Blastx: ABC transporter I family member 11, chloroplastic from Arabidopsis with 73.2% of identity
• Eggnog: ATPase activity(COG1122)
• Kegg: Link to kegg annotations (AT5G14100)
• CantataDB: Link to cantataDB annotations (CNT0001897)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429672.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;