Protein coding transcript 210776

• Transcript: Ll_transcript_226711
• CDS coordinates: 475-855 (+)
• Peptide sequence: MLYIFHSIFIQGGYGYAKNIKFMNIVMRNVTNPIIIDQNYCDQKEPCPEQESAVQLSNVVYQNIRGTSASEVAIKFECSKTVRCREIYLQDVILTPEDGGDTGTVAACENVVYANRGKLHPQCSFS*
• ORF Type: complete

Annotations of Ll_transcript_226711

• Blastp: Polygalacturonase from Persea with 62.75% of identity
• Blastx: Polygalacturonase from Persea with 62.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000254)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436071.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;