Protein coding transcript 210796

• Transcript: Ll_transcript_227145
• CDS coordinates: 893-1243 (+)
• Peptide sequence: MNGWDGIESEASSLASRSTSTQPVRLGRVQPQPPTHRTIFSNHRDANLHVRFKGNSISTTKFNFFTFLPKGLFEQFRRVANLYFLTISILSTTPISPVSPITNVLPLSLVLLVSLIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_227145

• Blastp: Phospholipid-transporting ATPase 3 from Arabidopsis with 70.75% of identity
• Blastx: Phospholipid-transporting ATPase 3 from Arabidopsis with 75% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G59820)
• CantataDB: Link to cantataDB annotations (CNT0000373)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431014.1)
• Pfam: Phospholipid-translocating ATPase N-terminal (PF16209.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;