Protein coding transcript 2108

• Transcript: Ll_transcript_324797
• CDS coordinates: 2-823 (+)
• Peptide sequence: IIFPFVTGPIFYQLHRNIYESFPLPIEKSSMTAIIHWTGVLTVTGFPVIAHTLSELKLLYTGLGKTALSAAMISDTYCWILFTILYPFTMNGNNVLYSVLSTVVFIVVCVFSVRPIICDYIEHKTDQDEWDDHQIVSVVMGVFVCSFITDFLGCHAIVGAFVYGLILPHGKFADLVTSVSDDFVNGFLTPLYFSSCGMRISFRSIFMMGNWPLVLLLVVSLILPKILSTVLATFFSGLHIQDGLALGLLLNTKGVIALVLLNSPWDKGVFSVPT
• ORF Type: internal

Annotations of Ll_transcript_324797

• Blastp: Cation/H(+) antiporter 15 from Arabidopsis with 33.45% of identity
• Blastx: Cation/H(+) antiporter 15 from Arabidopsis with 33.45% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT2G13620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459883.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;