Protein coding transcript 210835

• Transcript: Ll_transcript_225837
• CDS coordinates: 452-808 (+)
• Peptide sequence: MHHLGNPKFELIRHDVVEPLLLEVDQIYHLACPASLVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQAETYWGNVNPIGYSRERQVIVFRHILSNKIVIS*
• ORF Type: complete

Annotations of Ll_transcript_225837

• Blastp: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 92.78% of identity
• Blastx: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 89.26% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT3G62830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014507584.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;