Protein coding transcript 210837

• Transcript: Ll_transcript_225849
• CDS coordinates: 59-670 (+)
• Peptide sequence: MKYELVHCPSLIIIITTLFFHLLLHPSLSIALKIKKPKRILVTGGAGFVGSMGMGIICTKTCSQHVLGQQILVHLVDPQIERGDSVIVVDNFFTGRKVNVMHHLGNPKFELIRHDVVEPLLLEVDQIYHLACPASLVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQAETYWGNVNPIGEDCSYL*
• ORF Type: complete

Annotations of Ll_transcript_225849

• Blastp: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 73.81% of identity
• Blastx: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 86.82% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT3G62830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020225505.1)
• Pfam: Polysaccharide biosynthesis protein (PF02719.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;