Protein coding transcript 210838

• Transcript: Ll_transcript_225850
• CDS coordinates: 687-1043 (+)
• Peptide sequence: MCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQFPSVNFILEIAKHAFRFSKLSKRASKRWKLLLLDLQPEESARPRSLA*
• ORF Type: complete

Annotations of Ll_transcript_225850

• Blastp: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 97.18% of identity
• Blastx: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 86.82% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT2G47650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020225505.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;