Protein coding transcript 210943

• Transcript: Ll_transcript_226024
• CDS coordinates: 107-1390 (+)
• Peptide sequence: MIKEREQKKPFVWLIGNYAAELKFLLTTLLLLCTFVTFFQFIPSRFSISASDLRVCISRVSQVITPTPPSSISHLTTTNTTTTLSPPPPPPPSPSQEKLLPNGILKRVFNPYGSAAYNFVNMGAYRGGLKTFAIIGISSKPLHVYSKPTYECHWEQNINPNDTTTNMSKPMSTVGYKILPDWGYGRVYTVVIVNCTFSEPINNDNKGGKLILYASTSGGGDTNFNTTDKFEVLTEQPGTLDVSVFTSKPKYDYFYCGSSLFGNLSPQRIREWIAYHVKFFGPSSHFVIHDAGGVHEKVLEVLKPWMDLGYVTLQDIRDQERFDGYYHNQFMVLNDCLHRYKFMGKWMFFFDVDEYIYVPPKSTIKTVLDSLQEYNQFTIEQMPMSNKLCHTDDYGKSYRYIAFIAPFLFSCDFAKYFLLTHFVASLD*
• ORF Type: complete

Annotations of Ll_transcript_226024

• Blastp: Galactan beta-1,4-galactosyltransferase GALS3 from Arabidopsis with 56.83% of identity
• Blastx: Galactan beta-1,4-galactosyltransferase GALS3 from Arabidopsis with 56.72% of identity
• Eggnog: UPF0392 protein(ENOG410Z7P2)
• Kegg: Link to kegg annotations (AT4G20170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434966.1)
• Pfam: Glycosyltransferase family 92 (PF01697.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;