Protein coding transcript 21102

• Transcript: Ll_transcript_281866
• CDS coordinates: 2-334 (+)
• Peptide sequence: ALYNMNRAYLSLPEGTASVVGLIAMMTDHYNVLEESDSERDSNDAPGSRKPVKLKRGRFQLSVSKDSVQSQSIASDDGCLSLLKRRRTNGELPFIVPFTMVAYLYCFSHF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_281866

• Blastp: Protein ALWAYS EARLY 2 from Arabidopsis with 61.96% of identity
• Blastx: Protein ALWAYS EARLY 2 from Arabidopsis with 61.96% of identity
• Eggnog: lin-9 homolog (C. elegans)(ENOG410YA1T)
• Kegg: Link to kegg annotations (AT3G05380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440563.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;