Protein coding transcript 211024

• Transcript: Ll_transcript_225381
• CDS coordinates: 310-1011 (+)
• Peptide sequence: MSVPLEQGYVEIPAMEKNSENFSQRIKTTSSSGLNLKATELRLGLPGSESEGDENNVVYPLSLHSKFLVSGAKRGFSDAIGGGSGKWILSGNGDSEVGLGKDGNLFSPKGVIVAKALVGAECTNQDKVPHSSMTLNEKKHQISATAAKEQVVGWPPICSFRKNSMATQPQKNDEDVETKSGCLYVKVSMDGAPYLRKVDLKNFGTYRELSSALEKMFSCFTISEFFFSTCKLQ*
• ORF Type: complete

Annotations of Ll_transcript_225381

• Blastp: Auxin-responsive protein IAA27 from Arabidopsis with 48.79% of identity
• Blastx: Auxin-responsive protein IAA27 from Arabidopsis with 49.58% of identity
• Eggnog: auxin-responsive protein(ENOG410YEX5)
• Kegg: Link to kegg annotations (AT4G29080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436624.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;