Protein coding transcript 211044

• Transcript: Ll_transcript_60417
• CDS coordinates: 3006-3317 (+)
• Peptide sequence: MPKCINNCHNLEGFWKNWHASFNKWLVRYMYIPLGGSQKKLLNVWVIFTFVAVWHDLEWKLLSWAWLTCIFFIPELVLKSASKAFKAKSAFGEFIFRELSAVAG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_60417

• Blastp: Putative membrane-bound O-acyltransferase C24H6.01c from Schizosaccharomyces with 53.42% of identity
• Blastx: Putative membrane-bound O-acyltransferase C24H6.01c from Schizosaccharomyces with 27.73% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC24H6.01c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430164.1)
• Pfam: MBOAT, membrane-bound O-acyltransferase family (PF03062.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;