Transcript | Ll_transcript_60418 |
---|---|
CDS coordinates | 2202-2636 (+) |
Peptide sequence | MLCHSVIYLFQVLNFMWLKFLLIWRFFRFWSLINGIEAPENMPKCINNCHNLEGFWKNWHASFNKWLVRYMYIPLGGSQKKLLNVWVIFTFVAVWHDLEWKLLSWAWLTCIFFIPELVLKSASKAFKAKSAFGEFIFRELSAVAG |
ORF Type | 3prime_partial |
Blastp | Glycerol uptake protein 1 from Saccharomyces with 53.1% of identity |
---|---|
Blastx | Putative membrane-bound O-acyltransferase C24H6.01c from Schizosaccharomyces with 53.1% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YGL084C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430164.1) |
Pfam | MBOAT, membrane-bound O-acyltransferase family (PF03062.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer