Transcript | Ll_transcript_60146 |
---|---|
CDS coordinates | 178-1317 (+) |
Peptide sequence | MLNFFNRKYLRKFLKRKDSDAGEKGRALEDLRASLLNEFRSSEGANRLQQRFCGPATALTFNFLVAVGIIFMNKMVFQTIKFKYPILLTLIHYLVSWFLMAVLKVLSFLPASPSSKSTPLSTLFTLGFVMSLSTGFANVSLKYNSIGFYQMAKIAVTPSIVLAEFVLYRKKVSLQKVLALVVVSIGVAVATVTDLQFHFFGACVALAWIVPSAVNKILWSRLQQQENWTALSLMWKTTPITLVFLGAMLPFLDPPGVLLFDWNFRNTSVIFASAVLGFLLQLSGALALGATSAISHVVLGQFKTCILLLGNYYLFGSNPGKISICGAFTAIAGTSVYTYLNLKQQSNKVSPKQPPILPKSKLSNENGSTNDGHYGAESV* |
ORF Type | complete |
Blastp | Nucleotide-sugar uncharacterized transporter 2 from Arabidopsis with 65.41% of identity |
---|---|
Blastx | Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 70.76% of identity |
Eggnog | solute carrier family 35 member(ENOG410XP1S) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431126.1) |
Pfam | Triose-phosphate Transporter family (PF03151.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer