Protein coding transcript 21106

• Transcript: Ll_transcript_281838
• CDS coordinates: 618-959 (+)
• Peptide sequence: MELRSANTDILENQNDIECLKDSEAFKKHYATVLVELKEASGQVSDAMVHLRQRNTYTGNSLTPWLKPQVSFNDHDNLPGMLDSSLPQELGSTVNEIIKGSRLSANAMVDAAFQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_281838

• Blastp: Protein ALWAYS EARLY 3 from Arabidopsis with 39.13% of identity
• Blastx: Protein ALWAYS EARLY 3 from Arabidopsis with 40.46% of identity
• Eggnog: lin-9 homolog (C. elegans)(ENOG410YA1T)
• Kegg: Link to kegg annotations (AT3G21430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441175.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;