Transcript | Ll_transcript_281873 |
---|---|
CDS coordinates | 130-471 (+) |
Peptide sequence | MELRSANTDILENQNDIECLKDSEAFKKHYATVLVELKEASGQVSDAMVHLRQRNTYTGNSLTPWLKPQVSFNDHDNLPGMLDSSLPQELGSTVNEIIKGSRLSANAMVDAAFQ |
ORF Type | 3prime_partial |
Blastp | Protein ALWAYS EARLY 3 from Arabidopsis with 39.13% of identity |
---|---|
Blastx | Protein ALWAYS EARLY 3 from Arabidopsis with 38.84% of identity |
Eggnog | lin-9 homolog (C. elegans)(ENOG410YA1T) |
Kegg | Link to kegg annotations (AT3G21430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441177.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer