Protein coding transcript 211073

• Transcript: Ll_transcript_59984
• CDS coordinates: 620-1249 (+)
• Peptide sequence: MAGNGSEGLGDDFFEQILAVPEASYGRSMNDSGAMPMGLQLGAGSLGIRVGMPLGLNLEQGGGGGGDARSFSDTDNVEGSIDNNHNHHQQLLRLNNNGKSNNNSTSSSPPSTAGINDRDMQMIFEKLHNPPPTPTHAPCIRPMPLSTPPPPQPQRHHHHQHPFESQLQSPVSVAAMPRKPPGIRPRVRARRGQATDPHSIAERVRTGFT*
• ORF Type: complete

Annotations of Ll_transcript_59984

• Blastp: Transcription factor UNE12 from Arabidopsis with 82.14% of identity
• Blastx: Transcription factor UNE12 from Arabidopsis with 63.43% of identity
• Eggnog: Transcription factor(ENOG410YBM7)
• Kegg: Link to kegg annotations (AT4G02590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429166.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;