Protein coding transcript 211080

• Transcript: Ll_transcript_59968
• CDS coordinates: 2-592 (+)
• Peptide sequence: LIIIGFYSFLCVGFMQLRRERIAERMKALQELVPSINKTDRAAMLDEIMEYVKFLRLQVKVLSMSRLGGAGAVAQLVSDVPFSAVEVINLENIMLLFLYFMFFYIISTYSYFYLYQALNYTRNFFNSYVFGISTFAFTCCIFMHVESKLHYNRKIVYLVTWRSGFIKQTTFLFVRVRLHVCIYLLFRTLLNWSLVH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59968

• Blastp: Transcription factor bHLH66 from Arabidopsis with 76.56% of identity
• Blastx: Transcription factor bHLH66 from Arabidopsis with 75.38% of identity
• Eggnog: Transcription factor(ENOG4111MVP)
• Kegg: Link to kegg annotations (AT2G24260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429166.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;