Protein coding transcript 2111

• Transcript: Ll_transcript_324805
• CDS coordinates: 1149-2027 (+)
• Peptide sequence: MIFDDLRSQEAGNLYMHSFSEHTLRVTDVAIGNGGANAIIVSASEDWTCKVWSLATGTLLRNIVFPEVVIDNIVLDPAEHVFYAGGRNGKIYIAALNTESIPTNNYGKHILGSFSNQSKAVTCLAYGTSGDLLISGAEDGIVRVWDLRTRNIVRVFKHAKGPINNVVVVRRELDSSNPTSFNAQTSSRKHGSSLPPPLEKYPAGYEPSDTVLVSLGGGERHEDVKYVSHDVLMNSLKELQNQGSTAASEMEMEKLKHDSQRSMQMVNQWKKMYENLHEFCVKELLDGSKQQI*
• ORF Type: complete

Annotations of Ll_transcript_324805

• Blastp: Protein ROOT INITIATION DEFECTIVE 3 from Arabidopsis with 48.11% of identity
• Blastx: Protein ROOT INITIATION DEFECTIVE 3 from Arabidopsis with 50% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT3G49180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454514.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;