Protein coding transcript 211110

• Transcript: Ll_transcript_60407
• CDS coordinates: 677-1117 (+)
• Peptide sequence: MYTSSIYPVGILSVFLSMSLLFLFSIFNNVEEFTGATIKKGMVENNKSMADAKTDEEKGKIVIFIFWTCCMIFQKPKKQNATTGLWTCNNILTMTKPLYAKVPSFIGDKKINLSWKEVAKTAPSTTPTAGYIIFPFLLKIILFLFP*
• ORF Type: complete

Annotations of Ll_transcript_60407

• Blastp: Apoptosis inhibitor 5-like protein API5 from Oryza sativa with 45.56% of identity
• Blastx: Apoptosis inhibitor 5-like protein API5 from Oryza sativa with 45.56% of identity
• Eggnog: fibroblast growth factor binding(ENOG410XSH0)
• Kegg: Link to kegg annotations (4329135)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004505119.1)
• Pfam: Apoptosis inhibitory protein 5 (API5) (PF05918.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;