Protein coding transcript 211116

• Transcript: Ll_transcript_61262
• CDS coordinates: 218-805 (+)
• Peptide sequence: MESPFNVHLLPAKRPAPTGFSSDGQKKLNLSSNSPPYSEHEKTEHKTPGKLSNVVDYGNPFAVSDFLDCLDSGKFGSVTKDIESLLARKMQILGTYFAKYPTLLDHLVKEAVKHDEETHTPKSQQTAGLAQKSVIDLEGNHIEKKVPPTPLSVVIIDSDEEDDRDQKSSLPFHKVVLPKQASPAVRMTVSFSLVW*
• ORF Type: complete

Annotations of Ll_transcript_61262

• Blastp: Protein CHROMATIN REMODELING 35 from Arabidopsis with 31.33% of identity
• Blastx: Protein CHROMATIN REMODELING 35 from Arabidopsis with 31.33% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (AT2G16390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453437.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;