Transcript | Ll_transcript_61262 |
---|---|
CDS coordinates | 218-805 (+) |
Peptide sequence | MESPFNVHLLPAKRPAPTGFSSDGQKKLNLSSNSPPYSEHEKTEHKTPGKLSNVVDYGNPFAVSDFLDCLDSGKFGSVTKDIESLLARKMQILGTYFAKYPTLLDHLVKEAVKHDEETHTPKSQQTAGLAQKSVIDLEGNHIEKKVPPTPLSVVIIDSDEEDDRDQKSSLPFHKVVLPKQASPAVRMTVSFSLVW* |
ORF Type | complete |
Blastp | Protein CHROMATIN REMODELING 35 from Arabidopsis with 31.33% of identity |
---|---|
Blastx | Protein CHROMATIN REMODELING 35 from Arabidopsis with 31.33% of identity |
Eggnog | helicase(COG0553) |
Kegg | Link to kegg annotations (AT2G16390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453437.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer