Protein coding transcript 211138

• Transcript: Ll_transcript_60567
• CDS coordinates: 425-757 (+)
• Peptide sequence: MALLAEIEPVKVEEALQQKHWIEAMQDELMSIERNNTWSLMVLPKGKKTIIVKWVYKTKLNPNGEVSKYKARLVAKGYLQKQGLDYDEVFALVARLETVRLVIAIASHQS*
• ORF Type: complete

Annotations of Ll_transcript_60567

• Blastp: Uncharacterized mitochondrial protein AtMg00820 from Arabidopsis with 41.41% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 29.07% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp071)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465092.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;