Protein coding transcript 21115

• Transcript: Ll_transcript_281841
• CDS coordinates: 177-992 (+)
• Peptide sequence: MAPAKKSRSVSKRFSASNEVSPENDGVNSIKNKLRKKKLTDKLGSQWSKEELEQFYQAYRKYDKDWKKVAAVVRNRSIEMVEALYNMNRAYLSLPEGTASVVGLIAMMTDHYNVLVGSDSERESNDSPGSRKPLKRKIEKVHLSVSKDSVQSQSIASSDGCLSLLKKRRFDGIQPRAVGKRTPRVPVHYSCKKDDRENYASPNQRSLGSTVVVNDDEIAHVAALALAEAAQRGGSPQVSQTPHIRAEHKSPHVQNLERMVLIVHWLSLTII*
• ORF Type: complete

Annotations of Ll_transcript_281841

• Blastp: Protein ALWAYS EARLY 2 from Arabidopsis with 56.8% of identity
• Blastx: Protein ALWAYS EARLY 2 from Arabidopsis with 56.8% of identity
• Eggnog: lin-9 homolog (C. elegans)(ENOG410YA1T)
• Kegg: Link to kegg annotations (AT3G05380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441175.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;