Protein coding transcript 211161

• Transcript: Ll_transcript_60281
• CDS coordinates: 903-1340 (+)
• Peptide sequence: MKELSTTGFMSNRGRQIVCSFLVRDMGIDWRMGAEWFETCLLDYDPCSNYGNWTYGSGVGNDPREDRYFSIPKQAQTYDPEGEYVAFWLPQLGMIQRDKRNFPENLYIPQIVPLKFGKTGRHNEDKFSGARRGNDRVSERRWNKR*
• ORF Type: complete

Annotations of Ll_transcript_60281

• Blastp: Cryptochrome DASH, chloroplastic/mitochondrial from Oryza sativa with 75.76% of identity
• Blastx: Cryptochrome DASH, chloroplastic/mitochondrial from Oryza sativa with 76.3% of identity
• Eggnog: deoxyribo-dipyrimidine photolyase(COG0415)
• Kegg: Link to kegg annotations (4341749)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437682.1)
• Pfam: FAD binding domain of DNA photolyase (PF03441.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;