Protein coding transcript 211195

• Transcript: Ll_transcript_59887
• CDS coordinates: 129-971 (+)
• Peptide sequence: MEGAEKLNDEGYGGEAGNSRSEEFISDSLEKEENLVEDEKIEIANGEDLDVGIEVIETVLMSEEVKGVSSVVHAENKGPNGSLGVDGRSVSGAKRARVTTDEHQPSVHFIYNSLTRASRQKLEELLQQWSEWHEKHVSSSSDPSEVVESGEETFFPALKVGHEETSAVPFWMDNQTINDQNKDFIPLNHNSVPLYDRGFALGLTSADGPSNLDGGLEIIDAAARCFNCGSYSHSLRECTRPRDNVAVNNARKQLKSRRNQNASSRNPTRYYQSSPTGKYAG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_59887

• Blastp: Zinc finger CCHC domain-containing protein 8 homolog from Sophophora with 54.05% of identity
• Blastx: Zinc finger CCHC domain-containing protein 8 homolog from Sophophora with 54.05% of identity
• Eggnog: Zinc finger, CCHC domain containing 8(ENOG410XPDY)
• Kegg: Link to kegg annotations (Dmel_CG4622)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428177.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;